PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s735141g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Nin-like
Protein Properties Length: 799aa    MW: 88129.5 Da    PI: 7.4902
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s735141g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK919.2e-29433484152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  PDK_30s735141g001 433 AEKTISLEVLRQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKISKV 484
                        589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.938423504IPR003035RWP-RK domain
PfamPF020421.9E-25436484IPR003035RWP-RK domain
SuperFamilySSF542772.49E-18704789No hitNo description
PROSITE profilePS5174516.824704786IPR000270PB1 domain
SMARTSM006663.2E-21704786IPR000270PB1 domain
PfamPF005643.6E-13706785IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-22706785No hitNo description
CDDcd064072.44E-30706785No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MFKARMSQAL RYLKDSTNQH LLVQVWAPVK NGNRYVLTTS GQPFVLDPHS VGLLHYRTVS  60
VTYMFSEYPR LSHALHYNVR GTLALPVFEP YDQSCIGVVE LIMTSQKINY AGEVDKVCKA  120
LEAVNLKSSE ILDHPNVQIC NEGRQAALAE ILETLTMVCE AHKLPLAQTW VPCRHRSILA  180
HGGGSKKSCS SFDGGCMGQV CMSTTDAAFH VIDAHMWGFR EACTEHHLQK GQGVAGRAFA  240
SRRSCFSKDI TQFSKIDYPL VHYARMFGLA CCFALCLQST RTGNDDYILE FFLPPDCKDT  300
GEQLALLQSM RTMMEKCLRS LKVITDVELQ GGSSLEVIDM LEIRNQKSEP KPIYIRSCEN  360
RLHAFPEWNL VEALNEMQKE KHSMPELSEQ HFLTDANDGK NSKIVVDSNS TGTPSSSLVN  420
KNNKPLERRR GKAEKTISLE VLRQYFAGSL KDAAKSLGVC PTTMKRICRQ HGISRWPSRK  480
ISKVNRSLSK LKGVIESVHG PGGFDLTSLT GSLPVSVGSI SWPTKLDNSK QSKGVKVLDP  540
HGEREKGSLM HKSADDEDHC KKFIAPQDSV HDCTGIQLGP GKPSHSSKSG KSSAEGSMNP  600
PISEGSCQGN PMNETHTGKH FASSIKEIGE NPAQDLNRFG GCSISDAIAV EPQPSLGEIL  660
IKDSGSSKDL KDLCTSTMDD CRDEHTLGPA SDPSELRTIQ DLRTATIKVS YKEDILRFRL  720
GCTAGIMVLK NEIAKRLKLE IGTFDIRYLD DDHEWVMLAC NADLEECMEI SRLSGGRVIR  780
LSVNDILPSL GSSCESSGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783157.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLC5XJJ30.0C5XJJ3_SORBI; Putative uncharacterized protein Sb03g000490
STRINGSb03g000490.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7